Lorvenk Technologies

Senior Network Engineer

Lorvenk TechnologiesContract
MassachusettsH4-EAD, GC, GC-EAD, US Citizen, TN
8 - 15 YearsJun 16th, 2026
35 ViewsBe an Early Applicant
Required Skillset:
F5 Load BalancerInternetPrismaZscalerNetwork Access ControlPalo Alto FirewallNext Gen FirewallsTCP/IPCisco routingCisco switchingVPNBGPOSPFMPLSSIPSD-WANCCNPLANWANVLANQoSSASECCIEVXLANDNS/DHCPMP-BGPWiFiMeraki SD-WANVRFCCDPAruba Wireless EnvironmentQuality of ServiceSBCSpanning-Tree ProtocolMAN

Job Description

Role: Senior Network Engineer
Location: Lawrence, MA – hybrid (Local to MA only)
Duration: Long Term
Experience Required: 9+ Years 
Interview: In- person

 

***Looking for someone coming from Retail / Supply Chain domain

The Senior Network Engineer will work as part of New Balance Global Network Services to design, implement and support all network infrastructures including, but not limited to troubleshooting, configuring, project coordination and maintenance throughout the global New Balance environment. This position is hybrid in the New England region (primarily in Lawrence, MA).

MAJOR ACCOUNTABLITIES:
· Serve as Tier 2 and Tier 3 support for network operations in corporate, retail, cloud and data center network environments. Support typically involves advanced troubleshooting, maintenance, repair, provide root cause analysis and integration activities upon escalation.
· Implement enterprise-wide network solutions, upgrades and changes with a strong focus on network security (implementing / managing firewalls, crafting firewall policies, developing trust zone models, building systems/apps into trust zones, handling 3rd party connectivity requests, etc.).
· Interface with business unit and corporate stakeholders to consult and gather requirements for new projects including but not limited to understanding the business application workflows.
· Build and communicate a well-organized project implementation plan.
· Provide excellent client service while evaluating enhancements to the global networks by making use of technical knowledge, experience, and an in-depth understanding of switching, routing, and data flows.
· Conduct related technical analysis & planning for deployment of evolving technology solutions, leveraging architecture standards and design guides. Contribute to the development of such standards.
· Interface with various stakeholders regarding projects and requirements for new tech & services.
· Prepare technical solution designs and proposals, applying existing standards to meet business requirements including but not limited to addressing the business application workflows.
· Produce simple & concise documentation around project budgets, Implementation Plans, technical drawings, project management artifacts, business application workflows and operational handoffs as necessary.
· Project manage owned projects, ensuring successful delivery with an effective amount of organization and stakeholder communication.
· Guide junior engineers and vendors through configuration, implementation and operational activities.

EDUCATION & EXPERIENCE:
· Any combination (at least two) of University STEM degree, industry certification(s), e.g. CCIE, CCDP, CCNP, security cert, and/or cloud cert – or equivalent experience.
· Network product training / certification.
· 7+ years of related experience at multi-national corporate enterprises with at least 10,000 workers and 20+ countries.
· At least 4 of those 7 years in a lead design role for one or more large, complex networks.
· Experience with designing, building, and monitoring LAN, MAN, WAN, SD-WAN, MPLS, Internet, VPN, WiFi, DNS/DHCP, QoS, data center network environments.
· Extensive and substantial practical experience and applied knowledge of routing protocols BGP, IS-IS and OSPF.
· Extensive and substantial practical experience and applied knowledge of Spanning Tree Protocol.
· Knowledge of VXLAN fabric networks.
· Knowledge of MPLS label switching and MP-BGP routing.
· Experience mentoring junior engineers.
· Strong understanding of current-era data center network design, both internal data centers and cloud service provider environments.
· Experience with deploying and managing load balancers and remote access VPNs, Next Gen Firewalls.
· Experience dealing with compliance-related regulations like PCI, HIPAA, GDPR, etc. is preferred.
· Experience testing or implementing Network Access Control solutions.
· Network Operations/Administration experience is helpful, but candidate must have advanced into a sr. network design role.

REQUIRED TECHNICAL SKILLS:
· Layer 2 Spanning-Tree, VLAN.
· Layer 3 segmentation and advanced routing skills including VRF, Carrier (PE/CE) and Enterprise MPLS (L3VPN), OSPF, BGP.
· Advanced experience with Aruba Wireless Environment, Palo Alto Firewall, F5 Load Balancer, Cisco routing and switching, Meraki SD-WAN, TCP/IP.
· Demonstrable ability to break down and analyze network communications at the packet level.
· Experience with an Audio/Voice/Video integrated Network Environment including Quality of Service, SBC, SIP, AV protocols.
· Industry best practice approach to building segmented, hierarchical networks.
· Working knowledge with cloud security solutions such as Prisma, Zscaler, others. Familiarity with SASE concepts.

REQUIRED NON-TECHNICAL SKILLS:
· Self-starter with limited minimal supervision to meet the needs of a demanding business and IT environment.
· Ability to prioritize work and manage time effectively
· Willingness and availability to work flexible schedules as needed (e.g., for implementations or incident escalations), be available 24x7 for escalations, and potentially work in an on-call rotation that includes weekends.
· Ability to interact professionally and effectively with a diverse work force across the organization.
· Demonstrates strong communication skills resulting in clear, concise and consumable verbal (oral and listening) and written communications (proposals, scopes of work, solution summaries, etc.).
· Positive, collaborative, supportive, problem-solving approach to working within the organization including but not limited to the business units.
· Highly organized.
· Solutions-oriented.
· Customer-service oriented.
· Strong requirements gathering skills.
· Comprehends and applies architectures & frameworks to high-level/low-level engineering designs.
· Self-organizing and capable of autonomous execution.
· Seeks to understand customer perspective/feedback and informs leadership (voice of the customer).

Similar Jobs

Senior Network Engineer

MA

Jun 16th, 2026

Network Engineer

AZ

Jun 16th, 2026

Network Engineer

Remote

Jun 16th, 2026

Network Engineer - Level 3

NY

Jun 16th, 2026

Network Engineer

New York, Massachusetts

May 18th, 2026